DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTCH1 and Ptr

DIOPT Version :10

Sequence 1:NP_000255.2 Gene:PTCH1 / 5727 HGNCID:9585 Length:1447 Species:Homo sapiens
Sequence 2:NP_610209.2 Gene:Ptr / 35546 FlyBaseID:FBgn0262867 Length:1169 Species:Drosophila melanogaster


Alignment Length:77 Identity:15/77 - (19%)
Similarity:30/77 - (38%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


Human  1006 MIEACVKRTRTAFELKLQKANKTTDLRIPASVCTMFNVLVDAKKQSTKLCALDGGQEFRNQWQQ- 1069
            |::..::...|..:|..|:.:|..|..|..............:.|...|.....|:..|:.|:| 
  Fly     1 MLQLTIRSIHTDAKLLKQRCSKLVDRIIRVDQAGELGANQIYRGQLVILGHTKAGKTIRHMWEQE 65

Human  1070 --YHSKIDDLID 1079
              :.:..|.|::
  Fly    66 RAHKAAFDRLVN 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTCH1NP_000255.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
2A060602 43..1206 CDD:273338 15/77 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1189..1234
PHA03377 <1253..1369 CDD:177614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1270..1360
PtrNP_610209.2 Patched 53..845 CDD:308203 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.