DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTAFR and TkR86C

DIOPT Version :9

Sequence 1:NP_000943.1 Gene:PTAFR / 5724 HGNCID:9582 Length:342 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:371 Identity:76/371 - (20%)
Similarity:148/371 - (39%) Gaps:79/371 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    16 TLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLTMADMLFLITLPLWIVYYQNQ 80
            |::.|::.::..:.:..||.|||:.......:...  ..|::||::||:|......::...:...
  Fly    84 TIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVT--NYFLLNLSIADLLMSSLNCVFNFIFMLN 146

Human    81 GNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVTRPIKTAQANTRKRGISLSLV-IWVA 144
            .:|......|.:...:..:....||..|..|:::|:.|:..|:|   ..|.:|.:.:.|| ||..
  Fly   147 SDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLK---RRTSRRKVRIILVLIWAL 208

Human   145 IVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKGSVPVLIIH-----IFIVFSFFLVFLIILF 204
            ....::..|:..|..|.....|... |.||..:..|..|..:..     |.:|.::.:..:::|.
  Fly   209 SCVLSAPCLLYSSIMTKHYYNGKSR-TVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLI 272

Human   205 CNLVIIRTLL------MQPVQQQRNAEVKRRALWMVCTVLAVFIICFVPHHVVQLPWTLAELGFQ 263
            |..::.|.|.      ....:|..:.:.||:.:.|...::::|.||::|:|:           |.
  Fly   273 CYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHL-----------FF 326

Human   264 DSKFHQAINDAHQVT------------LCLLSTNCVLDPVIYCFLTKKFRKH------------- 303
            ...:|.     :||.            ..|..:|.:::|:||.::.|:||.:             
  Fly   327 IYAYHN-----NQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLT 386

Human   304 ----------LTEKFYSMRSSR----------KCSRATTDTVTEVV 329
                      ||.|..|.|.:|          ..|..||.|:..|:
  Fly   387 RHRFDSPKSRLTNKNSSNRHTRGGYTVAHSLPNSSPPTTQTLLAVL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTAFRNP_000943.1 7tmA_PAFR 16..304 CDD:320275 65/334 (19%)
TM helix 1 16..43 CDD:320275 7/26 (27%)
TM helix 2 52..77 CDD:320275 6/24 (25%)
TM helix 3 90..120 CDD:320275 7/29 (24%)
TM helix 4 132..154 CDD:320275 5/22 (23%)
TM helix 5 183..212 CDD:320275 5/33 (15%)
TM helix 6 225..255 CDD:320275 8/29 (28%)
TM helix 7 272..297 CDD:320275 7/36 (19%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 63/305 (21%)
7tm_1 100..363 CDD:278431 58/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.