DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-9i23.5 and lectin-22C

DIOPT Version :9

Sequence 1:NP_001139081.1 Gene:si:dkey-9i23.5 / 571862 ZFINID:ZDB-GENE-090313-364 Length:189 Species:Danio rerio
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:127 Identity:32/127 - (25%)
Similarity:54/127 - (42%) Gaps:16/127 - (12%)


- Green bases have known domain annotations that are detailed below.


Zfish    61 KYFF----SRLNFTLAEFKCRSKAPGAHLVSVHNSQDNNYLLCIVKKFNPKSLRIWLGAYEFFKS 121
            ||::    |..|::.|...||:.  |.||..:.:..|    |..:|....:....|||..:....
  Fly   145 KYYYIEKVSEKNWSTASKTCRNM--GGHLADIKDEAD----LAAIKANLKEDTHYWLGINDLDHE 203

Zfish   122 GEFFWL-DGSFWNFNRWVPGEPNHMYTSNEECLEMNWKEAGKWNDDKCNVRKSFICAFKRKE 182
            |:|..: .|....|.:|..|.|:.:.|.|  |:   :...|:..|..|:....|||..:.::
  Fly   204 GKFLSMPTGKQTTFLKWASGRPSQLDTLN--CV---FLYNGEMYDYPCHYTFRFICQTEEED 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-9i23.5NP_001139081.1 CLECT 58..176 CDD:153057 30/119 (25%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.