DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTR3B and Act87E

DIOPT Version :9

Sequence 1:NP_065178.1 Gene:ACTR3B / 57180 HGNCID:17256 Length:418 Species:Homo sapiens
Sequence 2:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster


Alignment Length:416 Identity:151/416 - (36%)
Similarity:224/416 - (53%) Gaps:59/416 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR-VLRGVDDLDFFIGDEAIDKPTY 72
            |||.|:|..|.|:||:..|:.:.||         :|.:.:.: |:.|:...|.::||||..|...
  Fly    10 VVDNGSGMCKAGFAGDDAPRAVFPS---------IVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 65

Human    73 AT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNV 136
            .| |:||.||||.:||.||:......:..||..||:|..|:||.|||...|||.:.:||||:||.
  Fly    66 LTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNA 130

Human   137 PGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDIT 201
            |.:|:|:||||:|.||       .|| ||||:||||||:|.:|:.|||.:...|..:.:||||:|
  Fly   131 PAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 187

Human   202 YFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKK 266
            .::.::|.||..........|..:.||||.||:..|..:|.|.            ...:...:|.
  Fly   188 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT------------AAASTSLEKS 240

Human   267 F------VIDVGYERFLGPEIFFHPEFANPDFMES--ISDVVDEVIQNCPIDVRRPLYKNVVLSG 323
            :      ||.:|.|||..||..|.|.|..   |||  |.:.|...|..|.:|:|:.||.|:|:||
  Fly   241 YELPDGQVITIGNERFRCPESLFQPSFLG---MESCGIHETVYNSIMKCDVDIRKDLYANIVMSG 302

Human   324 GSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTP 388
            |:||:.....|:|:::.                .:.|..::::::....::|:||.|||:|||..
  Fly   303 GTTMYPGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSILASLS 351

Human   389 EFFQVCHTKKDYEEYGPSICRHNPVF 414
            .|.|:..:|::|:|.||.|. |...|
  Fly   352 TFQQMWISKQEYDESGPGIV-HRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTR3BNP_065178.1 PTZ00280 2..417 CDD:240343 151/416 (36%)
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 150/414 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.