DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTR3B and Arp1

DIOPT Version :9

Sequence 1:NP_065178.1 Gene:ACTR3B / 57180 HGNCID:17256 Length:418 Species:Homo sapiens
Sequence 2:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster


Alignment Length:408 Identity:137/408 - (33%)
Similarity:211/408 - (51%) Gaps:61/408 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 PCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID-KP 70
            |.|:|.|:|..|.|:||...|:...|:.|...:..        ||:.|..:.|.|:|.:|.: :.
  Fly    11 PVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHV--------RVMAGALEGDIFVGPKAEEHRG 67

Human    71 TYATKWPIRHGIIEDWDLMERFMEQVVFK-YLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134
            ..:.::|:.|||:.||:.|||....:..| .|....|||..|:||.|||...|||..||..||..
  Fly    68 LLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGI 132

Human   135 NVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRD 199
            |.|.|::::||||:|.|  |.|      :||:|:||||||||.:|:.||:.:...|..:.|||||
  Fly   133 NAPALFVSMQAVLSLYA--TGR------VTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRD 189

Human   200 ITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQ 264
            :|.:::.|:|............|..::||||.||:..:..||                  ..:..
  Fly   190 VTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE------------------ETVET 236

Human   265 KKF--------VIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVL 321
            :||        :.::|..||..||:.|.|:....: .|.|.||:...|:...:|:|:.||:|:||
  Fly   237 EKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEE-CEGIHDVLMYSIEKSDMDLRKMLYQNIVL 300

Human   322 SGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLAS 386
            |||||:|:.||.||..:||                :...|.:::::.....:.|:.|.|||:|||
  Fly   301 SGGSTLFKGFGDRLLSELK----------------KHSAKDLKIRIAAPQERLYSTWMGGSILAS 349

Human   387 TPEFFQVCHTKKDYEEYG 404
            ...|.::..:|::|||.|
  Fly   350 LDTFKKMWISKREYEEEG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTR3BNP_065178.1 PTZ00280 2..417 CDD:240343 137/408 (34%)
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 137/408 (34%)
ACTIN 9..376 CDD:214592 137/408 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.