DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTR3B and Arp53D

DIOPT Version :9

Sequence 1:NP_065178.1 Gene:ACTR3B / 57180 HGNCID:17256 Length:418 Species:Homo sapiens
Sequence 2:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster


Alignment Length:412 Identity:146/412 - (35%)
Similarity:209/412 - (50%) Gaps:56/412 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKPT-- 71
            |:|.|:|..|.|::....|:.:.||.:.......|:             ||..|||..|.:..  
  Fly    50 VIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVL-------------LDSVIGDSVIGEAAAR 101

Human    72 ----YATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFE 132
                ...|:||.||::::||.|| .:.|..::.|||:|.|...|:||.|||..:|||.:.|||||
  Fly   102 KRGILTLKYPIEHGMVKNWDEME-MVWQHTYELLRADPMDLPALLTEAPLNPKKNREKMTEIMFE 165

Human   133 SFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAG 197
            .|.||..|:||||||:|.|  |.|.|      |||:||||||||.:|:.||:.:......:.:||
  Fly   166 HFQVPAFYVAVQAVLSLYA--TGRTV------GIVVDSGDGVTHTVPIYEGFALPHACVRVDLAG 222

Human   198 RDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAI 262
            ||:|.::.:||.||.|.:......|..:.||||.||:..:..||     :|....::.|   ...
  Fly   223 RDLTDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKE-----MDLHGKVETY---ELP 279

Human   263 NQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTM 327
            :.:|.|:  |.|||..||..|.|.....:.| .|.:.....|.||.:|:|:.:|.|:|||||:||
  Fly   280 DGQKIVL--GCERFRCPEALFQPSLLGQEVM-GIHEATHHSITNCDMDLRKDMYANIVLSGGTTM 341

Human   328 FRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQ 392
            ||:...|..:||..:....:|:....|..|                |::||.|||:|||...|..
  Fly   342 FRNIEHRFLQDLTEMAPPSIRIKVNASPDR----------------RFSVWTGGSVLASLTSFQN 390

Human   393 VCHTKKDYEEYGPSICRHNPVF 414
            :.....:|||.|.:|. |...|
  Fly   391 MWIDSLEYEEVGSAIV-HRKCF 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTR3BNP_065178.1 PTZ00280 2..417 CDD:240343 146/412 (35%)
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 145/410 (35%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 145/410 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.