DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RTN4 and Rtnl2

DIOPT Version :10

Sequence 1:NP_065393.1 Gene:RTN4 / 57142 HGNCID:14085 Length:1192 Species:Homo sapiens
Sequence 2:NP_524263.2 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster


Alignment Length:187 Identity:61/187 - (32%)
Similarity:98/187 - (52%) Gaps:13/187 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   981 LPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIAL 1045
            :.:||..:.:..|.||      ..:.:||.||:.:||.:||...|.|||.:.|.|::||.:.:.:
  Fly     1 MSTDTLIKAKDSSQIF------MDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGI 59

Human  1046 ALLSVTISFRIYKGVIQ--AIQKSDEGHP--FRAYLESEVAISEELVQKYSNSALGHVNCTIKEL 1106
            .:|...|..|:   ::|  :|.|.||...  .|.|...::.|..|.....:..|:.|:|..:..:
  Fly    60 TVLIAAIGHRL---LVQFWSIWKKDENKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRM 121

Human  1107 RRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQID 1163
            ..|.||:...|||||.||:.....:|..||||||||...:.:|:||.:||.::..:|
  Fly   122 IELLLVEKWEDSLKFLVLLCGINLLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RTN4NP_065393.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..458
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 722..762
Reticulon 1005..1169 CDD:460562 56/163 (34%)
Rtnl2NP_524263.2 Reticulon 21..184 CDD:460562 56/161 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.