DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAZ4 and bol

DIOPT Version :9

Sequence 1:NP_001375413.1 Gene:DAZ4 / 57135 HGNCID:15966 Length:723 Species:Homo sapiens
Sequence 2:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:103/282 - (36%) Gaps:94/282 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   182 ASTQSSSAAASQGWVLP-----EGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRT 241
            |:....||....|...|     .|.::||.:|||||.....|.::...|..||:||..|||.:|.
  Fly     5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69

Human   242 GVSKGYGFVSFVNDVDVQKIV--GSQIHFHGKKLKLGPAIRKQKLCARHVQPRPL---------- 294
            |||||||||:|..:.:.|::.  |..:....:||.:.|||:|        ||.||          
  Fly    70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK--------QPNPLQSIVATNGAV 126

Human   295 --VVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEY 357
              ...||.|                   |:..|:.|.  |.:.||........|...:       
  Fly   127 YYTTTPPAP-------------------ISNIPMDQF--AAAVYPPVTDFTAAGVPAI------- 163

Human   358 PTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQ--------AFPAYPNSPFQ 414
              ||.||.|           ||||..|...|..|...:.   .|||        :..:.|:||..
  Fly   164 --YPPSAMQ-----------YQPFYQYYSVPMNVPTIWP---QNYQENHSPLLHSPTSNPHSPHS 212

Human   415 VATGYQFPVYNYQPFPAYPSSP 436
                           .::|.||
  Fly   213 ---------------QSHPQSP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAZ4NP_001375413.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
RRM_DAZL 35..116 CDD:410073
PABP-1234 42..412 CDD:130689 71/256 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..192 3/9 (33%)
RRM_DAZL 200..281 CDD:410073 35/82 (43%)
Daz 407..427 CDD:408642 3/19 (16%)
Daz 431..451 CDD:408642 3/6 (50%)
Daz 455..475 CDD:408642
Daz 479..499 CDD:408642
Daz 503..523 CDD:408642
Daz 527..547 CDD:408642
Daz 551..571 CDD:408642
Daz 575..595 CDD:408642
Daz 599..619 CDD:408642
Daz 623..643 CDD:408642
Daz 647..667 CDD:408642
Daz 671..691 CDD:408642
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 34/79 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.