DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMD7 and psmd7

DIOPT Version :10

Sequence 1:NP_002802.2 Gene:PSMD7 / 5713 HGNCID:9565 Length:324 Species:Homo sapiens
Sequence 2:NP_001032349.1 Gene:psmd7 / 447971 XenbaseID:XB-GENE-1005422 Length:320 Species:Xenopus tropicalis


Alignment Length:61 Identity:16/61 - (26%)
Similarity:25/61 - (40%) Gaps:22/61 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   344 LRSCLDCIGKNAIILKSQISLLPPKLLQQVLKKITFWTAANYRKEQRIRKEETENNQPRVS 404
            |.||...:||.|:          .|.::::.::|        |||    |||.|....:.|
 Frog   325 LTSCTKEVGKAAL----------EKQIEEINEQI--------RKE----KEEAEARMRQAS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMD7NP_002802.2 MPN_RPN7_8 7..285 CDD:163693
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..324
psmd7NP_001032349.1 MPN_RPN7_8 7..285 CDD:163693
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.