DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMD7 and eIF3f1

DIOPT Version :9

Sequence 1:NP_002802.2 Gene:PSMD7 / 5713 HGNCID:9565 Length:324 Species:Homo sapiens
Sequence 2:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster


Alignment Length:286 Identity:83/286 - (29%)
Similarity:141/286 - (49%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     9 VVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE-DDKDDSVWFLDH 72
            |.|||:||..|||.|.|  :..:..||:|.||||..|.|::|:|.|.||..| ||:.::    :.
  Fly     8 VRVHPVVLFQVVDAFER--RNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEA----EL 66

Human    73 DYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEA 137
            .|..:||.:.:|||:.|.:|||:.||..:..:...|:|...|.|.|.|.:.:|...:...:...|
  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRA 131

Human   138 YISVEEVHDDGTPTSKT---FEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLK 199
            |:.::.    |.|..|:   |..:..|:.:.|.|..|::.|.:     |||.........|..:.
  Fly   132 YVCIQL----GVPGGKSGCMFTPIPVELTSYEPETFGLKLLQK-----TVGVSPAHRPKTVPPML 187

Human   200 GLN---------SKLLD-IRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTN 254
            .|.         ..||| |..|::.|...|:..::.:..||.|:.:.:|.::.::|.:.|.....
  Fly   188 DLAQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVR 252

Human   255 DQMVVVYLASLIRSVVALHNLINNKI 280
            :.::|:.|:.||::.:.|    |.|:
  Fly   253 NLLLVITLSQLIKTQLQL----NEKL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMD7NP_002802.2 MPN_RPN7_8 7..285 CDD:163693 83/286 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..324 83/286 (29%)
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 82/284 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.