DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NAT14 and CG18542

DIOPT Version :10

Sequence 1:NP_065111.1 Gene:NAT14 / 57106 HGNCID:28918 Length:206 Species:Homo sapiens
Sequence 2:NP_649928.1 Gene:CG18542 / 41176 FlyBaseID:FBgn0037731 Length:249 Species:Drosophila melanogaster


Alignment Length:67 Identity:10/67 - (14%)
Similarity:28/67 - (41%) Gaps:13/67 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     8 VREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLASFALALLLPVFL 72
            :|...:|::....|:::..:....|:          :..:.......|:|::.::|:..   :||
  Fly     7 IRNYTQDDELKCQELVRDYIMSFSNK----------SFFVYCFREITLQFIVITWAIFF---IFL 58

Human    73 AV 74
            .|
  Fly    59 GV 60

Return to query results.
Submit another query.