DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLSCR4 and scramb2

DIOPT Version :9

Sequence 1:NP_001121776.1 Gene:PLSCR4 / 57088 HGNCID:16497 Length:329 Species:Homo sapiens
Sequence 2:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster


Alignment Length:272 Identity:106/272 - (38%)
Similarity:148/272 - (54%) Gaps:23/272 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    56 LPMGYYSPQQPSTFPLYQP----VGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYL 116
            ||..  :||..:...:.||    ||.              |.:.|..||..|..|.|||.|||||
  Fly    10 LPQN--APQDENGAVVLQPQAANVGN--------------NANGPENWMSIPVGMPNCPQGLEYL 58

Human   117 VQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDC 181
            ..||.:.|.|..|.||::|.|||.||:.:||:..|.||...|::|..|||.....|||.:::.|.
  Fly    59 TALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDN 123

Human   182 MGREIMTMQRPFRCTCCCFCCPSARQELEVQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRV 246
            ...|::.:.|||:|...| |.||....:||..|||..||.|.:.....|..::|:|...:.|:::
  Fly   124 FQNEVLHLYRPFKCDILC-CFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQI 187

Human   247 RGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWNGL-LSAMADADHFDIHFPLDLDVKMKAMIFG 310
            .||.....|.||:.|:|.|.:. ..||.|.::|:|| .....|||:|.:.|||:|||:|||:||.
  Fly   188 EGPVCPCKCFSDTNFKVLSANN-EEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFA 251

Human   311 ACFLIDFMYFER 322
            |.||||.:|:|:
  Fly   252 ALFLIDAVYYEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLSCR4NP_001121776.1 Proline-rich domain (PRD). /evidence=ECO:0000250 1..98 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
SH3-binding 1. /evidence=ECO:0000255 18..25
PPxY motif. /evidence=ECO:0000255 30..33
Atrophin-1 <36..100 CDD:331285 10/47 (21%)
SH3-binding 2. /evidence=ECO:0000255 41..49
SH3-binding 3. /evidence=ECO:0000255 98..106 3/7 (43%)
Scramblase 100..322 CDD:252175 94/222 (42%)
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 94/222 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.