DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMC4 and Rpt2

DIOPT Version :9

Sequence 1:NP_006494.1 Gene:PSMC4 / 5704 HGNCID:9551 Length:418 Species:Homo sapiens
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:399 Identity:195/399 - (48%)
Similarity:290/399 - (72%) Gaps:13/399 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    31 GPE-----PEDLEDLYSRYK--KLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSI--- 85
            ||:     |:.......|.|  ||::..::|.:::|:|:: |:.||.:....:||..::..:   
  Fly    41 GPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRN-QERLKPQDEKNEEERSKVDDLRGT 104

Human    86 PLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSS 150
            |:.:|...|.:|.|.|||.::.||.:||.|||.:|::.|:|..||.|:...:|:|.||..:.|..
  Fly   105 PMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPM 169

Human   151 IMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTML 215
            :.::..::.|...||||||:|.|.||::|:|||||||.|.|:::||.||:||::|||||.|||:|
  Fly   170 VTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLL 234

Human   216 AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG 280
            |||||:.|:|.|:||||||.:|||||:||::||::||:|:|:||:|:|||||||:.|||:|:.:|
  Fly   235 AKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSG 299

Human   281 ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIF 345
            .:||:||.:||||||:||||...:|||||||||.:||||||:||||:||||||||||.:.||.||
  Fly   300 GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIF 364

Human   346 STITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVI--K 408
            :..||:|.|:|:|:|.:.:...|.:|||||.:||.|:|::|:||.|..|..:||:|:.::|:  |
  Fly   365 TIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRK 429

Human   409 KDEQEHEFY 417
            |:......|
  Fly   430 KEGTPEGLY 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMC4NP_006494.1 PTZ00454 34..418 CDD:240423 193/391 (49%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 195/399 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.