DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOC570115 and His2A:CG33829

DIOPT Version :9

Sequence 1:XP_698647.2 Gene:LOC570115 / 570115 -ID:- Length:128 Species:Danio rerio
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:125 Identity:112/125 - (89%)
Similarity:119/125 - (95%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65
            |||||| |||.:.|||:||:||||||||||:||||||||||||||||||||||||:|||.||:||
  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64

Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||.|
  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOC570115XP_698647.2 PTZ00017 1..128 CDD:185399 112/125 (90%)
H2A 6..120 CDD:238029 101/113 (89%)
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 99/107 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100077
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.