DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMC1 and CG8298

DIOPT Version :10

Sequence 1:NP_002793.2 Gene:PSMC1 / 5700 HGNCID:9547 Length:440 Species:Homo sapiens
Sequence 2:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster


Alignment Length:79 Identity:15/79 - (18%)
Similarity:26/79 - (32%) Gaps:37/79 - (46%)


- Green bases have known domain annotations that are detailed below.


Human    96 RSKVDDLR---GTPMS--------------VGTLEEIIDDNHAIV-------------------- 123
            |..||.:|   |.|:|              |..:...|::|..:.                    
  Fly   131 RHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDSWLLWNLTGGVEMGVH 195

Human   124 STSVGSEHYVSILS 137
            ||.:.:.||.|:::
  Fly   196 STDITNAHYTSLMN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMC1NP_002793.2 PTZ00361 1..440 CDD:185575 15/79 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 4/10 (40%)
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.