DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX9 and Lhx9

DIOPT Version :9

Sequence 1:XP_011508083.2 Gene:LHX9 / 56956 HGNCID:14222 Length:403 Species:Homo sapiens
Sequence 2:XP_006249976.1 Gene:Lhx9 / 289048 RGDID:727956 Length:397 Species:Rattus norvegicus


Alignment Length:379 Identity:376/379 - (99%)
Similarity:378/379 - (99%) Gaps:0/379 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    25 AMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYY 89
            ||||||||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||
  Rat    19 AMLFHGISGGHIQGIMEEMERRSKTEARLAKGTQLNGRDAGMPPLSPEKPALCAGCGGKISDRYY 83

Human    90 LLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR 154
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    84 LLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR 148

Human   155 ARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLAL 219
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   149 ARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLAL 213

Human   220 PYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQ 284
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   214 PYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQ 278

Human   285 LRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLP 349
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   279 LRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLP 343

Human   350 APPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF 403
            ||||||||||||||||||||||||||:||||:||||||||||||||||||||||
  Rat   344 APPSADSGALTPPGTATTLTDLTNPTVTVVTTVTSNMDSHESGSPSQTTLTNLF 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX9XP_011508083.2 None
Lhx9XP_006249976.1 LIM1_Lhx2 61..124 CDD:188853 62/62 (100%)
LIM2_Lhx2_Lhx9 129..187 CDD:188763 57/57 (100%)
Homeobox 271..324 CDD:395001 52/52 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83679649
Domainoid 1 1.000 168 1.000 Domainoid score I28996
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7816
Inparanoid 1 1.050 782 1.000 Inparanoid score I7740
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43226
OrthoDB 1 1.010 - - D1174930at2759
OrthoFinder 1 1.000 - - FOG0002416
OrthoInspector 1 1.000 - - oto135867
orthoMCL 1 0.900 - - OOG6_105440
Panther 1 1.100 - - LDO PTHR24208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1515.410

Return to query results.
Submit another query.