DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igsf9bb and DIP-epsilon

DIOPT Version :10

Sequence 1:XP_068072154.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1448 Species:Danio rerio
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:391 Identity:103/391 - (26%)
Similarity:156/391 - (39%) Gaps:72/391 - (18%)


- Green bases have known domain annotations that are detailed below.


Zfish     8 LIASVFSTRGTAAQGAHG----------VREEPQF------VTSRAGETVILGCDVVHPLNGQPY 56
            :.:||..:..|.::|..|          :.|:|:|      :|..||..|.|.|.|   .|...|
  Fly    20 IASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSV---KNLGSY 81

Zfish    57 VVEWFKFGVPIPFFINFRFYPPHV---DPEYAGRASLHGKSS---LRIERVRSEDQGWYECKV-- 113
            .|.|..|.......::     .||   :|..:.....|.|..   |.|..|:.||:|.|.|::  
  Fly    82 KVAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINT 141

Zfish   114 LMLEQQYHTFHNGSWVHLTVNAPPTFTDT-PPQYVEAKEGGSITLSCTAFGNPKPSVSWLR-EGN 176
            :..:.||      .:|.:.|  ||...|. ....:..:||.::||.|.|.|:|:|::.|.| :||
  Fly   142 VTAKTQY------GFVKVVV--PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGN 198

Zfish   177 PVQDSTKYKVSD---GSLTLVSISREDRGAYTCRAYSEQGEAV-HTTRLLVQGPPFIVSPPENIT 237
            .:..:...:|.|   .||.|..|||...|||.|.|.:....:| ...::.|...|.:..|.:.:.
  Fly   199 KIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVG 263

Zfish   238 VNISQDAFFTCQAEAYPGNLTYTWFWEEDNVFFKNDLKRRVSILIDGS------LIISQVKPEDA 296
            :.|..:....|..||.|.:|.| |..|.|.:..::...:..:|....|      |.|:.|:..|.
  Fly   264 IPIGFNITLECFIEANPTSLNY-WTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDY 327

Zfish   297 GKYTCSPSNSLG-----------RPPSASAYLTVHYPARVINMPPVIYVA--IGLPGYIRCPVDA 348
            |.|.|...|..|           .||      |...|.....:......|  |.|.|||..|::.
  Fly   328 GNYKCVAKNPRGDMDGNIKLYMSSPP------TTQPPPTTTTLRRTTTTAAEIALDGYINTPLNG 386

Zfish   349 N 349
            |
  Fly   387 N 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
igsf9bbXP_068072154.1 Ig 41..113 CDD:409353 22/77 (29%)
Ig strand B 41..45 CDD:409353 2/3 (67%)
Ig strand C 57..61 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/6 (17%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
IG_like 144..223 CDD:214653 27/83 (33%)
Ig strand B 155..159 CDD:409353 2/3 (67%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 189..193 CDD:409353 2/3 (67%)
Ig strand F 203..208 CDD:409353 3/4 (75%)
Ig strand G 216..219 CDD:409353 1/3 (33%)
Ig 227..319 CDD:472250 25/108 (23%)
Ig strand B 244..248 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 284..288 CDD:409353 2/9 (22%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 312..315 CDD:409353 0/2 (0%)
Ig <343..403 CDD:472250 2/7 (29%)
Ig strand C 353..358 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 392..397 CDD:409353
Ig 427..504 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 449..453 CDD:409353
Ig strand E 470..474 CDD:409353
Ig strand F 484..489 CDD:409353
FN3 <489..>734 CDD:442628
Ig strand G 497..500 CDD:409353
FN3 509..604 CDD:238020
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/109 (26%)
Ig strand B 69..73 CDD:409353 2/3 (67%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 1/6 (17%)
Ig 157..249 CDD:472250 29/91 (32%)
Ig strand B 176..180 CDD:409289 2/3 (67%)
Ig strand C 189..193 CDD:409289 0/3 (0%)
Ig strand E 213..218 CDD:409289 2/4 (50%)
Ig strand F 228..233 CDD:409289 3/4 (75%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653 20/81 (25%)
Ig strand C 283..287 CDD:409394 2/4 (50%)
Ig strand E 313..319 CDD:409394 1/5 (20%)
Ig strand F 329..334 CDD:409394 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.