DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NIT2 and CG32751

DIOPT Version :9

Sequence 1:NP_064587.1 Gene:NIT2 / 56954 HGNCID:29878 Length:276 Species:Homo sapiens
Sequence 2:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster


Alignment Length:318 Identity:70/318 - (22%)
Similarity:117/318 - (36%) Gaps:98/318 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     4 FRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPE---------------------CFNS 47
            :...:::.:.|:..|||:......|:........|:..||                     |.:.
  Fly    33 YTAGVVEFEPSNELSDNLAGYLEIIQSQNATSTDIIVFPESTLNSAGSTTFVPNPEDQINPCLSD 97

Human    48 PYGAKYFPEYAEKIPGESTQKLSEVAKECSIYLIGG--------SIPEE------DAGKLYNTCA 98
            | .|.|:.|:        ...||..|:..|.|::..        .|||:      :...::||..
  Fly    98 P-NATYYEEF--------LVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNV 153

Human    99 VFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPY-CRVGLGICYDMRFAELA 162
            ||...|.::::|||:||:     |:   .::.|..|  ..|||:|.: ...|..||:|:.|...|
  Fly   154 VFDRQGVVVSRYRKVHLY-----GE---PKNSTFLP--ELSTFETDFGVTFGHFICFDILFYTPA 208

Human   163 -QIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPARDDKASYV--AWGHSTV 224
             |:..::|....||         ||.|         .:|:...|.:.....||..:  .|.::..
  Fly   209 HQLIVEQGITDFVY---------PAMW---------FSQLPFLTVNGIFSSKAVQIQLGWSYANN 255

Human   225 VNPWGEVLAKAGTEEAIV-------YSDIDLKKLAEIRQQ----------IPVFRQKR 265
            ||     |..||..:.||       |........:.:||:          :|.:|.||
  Fly   256 VN-----LLAAGASDPIVGNSGSGIYHGRSGSLRSVMRQESGERSIYVARVPKYRAKR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NIT2NP_064587.1 nit 5..265 CDD:143596 68/315 (22%)
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 70/318 (22%)
Vanin_C 324..503 CDD:408788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.