DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CMC2 and CG42375

DIOPT Version :10

Sequence 1:NP_064573.1 Gene:CMC2 / 56942 HGNCID:24447 Length:79 Species:Homo sapiens
Sequence 2:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster


Alignment Length:81 Identity:37/81 - (45%)
Similarity:48/81 - (59%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     1 MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYV----ENRTKSRE 61
            ||.|||.||||..||.||..|:.||:|:...||.|.||.:|.::.||||.|.:    .||.|:||
  Fly     1 MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARE 65

Human    62 HGIAMRKKLFNPPEES 77
            .....::||..  :||
  Fly    66 RQAKYKEKLLQ--QES 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CMC2NP_064573.1 Cmc1 1..70 CDD:400756 33/72 (46%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 14..24 5/9 (56%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 3/9 (33%)
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 33/69 (48%)

Return to query results.
Submit another query.