DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment npr3 and Gyc76C

DIOPT Version :9

Sequence 1:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio
Sequence 2:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster


Alignment Length:508 Identity:95/508 - (18%)
Similarity:179/508 - (35%) Gaps:178/508 - (35%)


- Green bases have known domain annotations that are detailed below.


Zfish    89 RQKDERPDLVL--------------------GPVCEYAASSVTRVASHWNIPVIS-------AGA 126
            |..|.:.|.||                    ||....|..|.:|     |||:||       |.|
  Fly    72 RWNDTKGDTVLATKAITEMICDGIATIFGPEGPCYVEAIVSQSR-----NIPMISYKCAEYRASA 131

Zfish   127 LATGFNSKTPEYSHLTRIAPTYLKMAETFQAIFGHFGWRTAYLIYDDDKDERNCYFTMEGVFTVL 191
            :.|...::.|:    |::..:.|       |:..::.|....::|:|         ....|..:|
  Fly   132 IPTFARTEPPD----TQVVKSLL-------ALLRYYAWNKFSILYED---------VWSPVADLL 176

Zfish   192 SEYHISTDFAVLNSNEERVDPDGIITSVYGSEVVIMCSKA----DIVRDLMLAAHRRKL-----T 247
            .:.....:..: |..:..:|     ..|...|.::.|.::    .:|::.|   :|.::     .
  Fly   177 KDQATKRNMTI-NHKQSFID-----NRVKCCEQMLDCCRSGYWYQLVQNTM---NRTRIYVFLGA 232

Zfish   248 SDSHIFFNIELFNSSSYGDGSW------------RRRDKY----------------DDEARAAYS 284
            ::|.:.|...:..:..:..|.:            |..:||                ::..:.|.|
  Fly   233 ANSLVDFMSSMETAGLFARGEYMVIFVDMMVYSEREAEKYLRRVDQITFMSNCHSTENFNQMARS 297

Zfish   285 FLNTVTLLRSTKPEFE---------------DFSIEMKKSLQQSNIPICEDCSAVNMFMEGFHDA 334
            .|    ::.||.|..:               .|::|:.:...:||.     ...::::....:|:
  Fly   298 LL----VVASTPPTKDYIQFTKQVQKYSSKPPFNLEIPRLFVESNF-----SKFISIYAAYLYDS 353

Zfish   335 LLLYAIA----LREVKSKGLT-------KKNGLEITHS-MWNRTFEGIAG-QVSLDANGDRNGDF 386
            :.|||.|    ||| :::.||       ..||..:..: :.|||:..|.| ::.:|..||..|:|
  Fly   354 VKLYAWAVDKMLRE-ETRVLTDDVIFEVASNGTRVIDTIIKNRTYMSITGSKIKIDQYGDSEGNF 417

Zfish   387 SVV--------RMTDPESGKHETVMNYFG----------TNGSFQILPGFKREWFSLRTIPPPKP 433
            ||:        ...:.....|...:.||.          .|||.        :|.|    ...||
  Fly   418 SVLAYKPHKWNNSNNMPCNYHMVPVAYFHQGEEHPEYKLINGSI--------DWPS----GGEKP 470

Zfish   434 LDPSSGGLG-----------VSAVTGIIVGGILGTALLLAFYFFRKNYRITIE 475
            .|....|..           .|.|..:::|.:|..:.::....:|| ::|.:|
  Fly   471 ADEPMCGFANELCKKDDTHYTSTVAAVVLGVLLFCSGVITMSIYRK-WKIELE 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 81/436 (19%)
ANF_receptor 46..389 CDD:279440 74/391 (19%)
TM_EphA1 436..468 CDD:214014 5/42 (12%)
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365 76/416 (18%)
ANF_receptor 48..412 CDD:279440 69/383 (18%)
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003
CYCc 860..1052 CDD:214485
Guanylate_cyc 887..1074 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.