DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMB4 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_002787.2 Gene:PSMB4 / 5692 HGNCID:9541 Length:264 Species:Homo sapiens
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:258 Identity:103/258 - (39%)
Similarity:157/258 - (60%) Gaps:6/258 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    11 LWAGGPAPGQFYRIP--STPDSFMDPASALYRGP--ITRTQNPMVTGTSVLGVKFEGGVVIAADM 71
            :|..|||||:||...  .||...: |......||  ...:.....|||||||::::.||::|||.
  Fly    12 MWQNGPAPGEFYNFTGGQTPVQQL-PRELTTMGPYGTKHSTASSTTGTSVLGIRYDSGVMLAADT 75

Human    72 LGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSW 136
            |.||||:||::||.|:.:||.:.:||.|||:||.|.:|:.:.|.:|:::...|.....|:::.||
  Fly    76 LVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASW 140

Human   137 LTRAMYSRRSKMNPLWNTMVIGGY-ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLE 200
            :||.:|:|||:||||:..:|:||. .:|..:|..||:.|.:||...:|||:..:||.||:||...
  Fly   141 MTRVLYNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKP 205

Human   201 KQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGF 263
            |....:..||.:|:..||.||||||.|:.:::.:...:..|..:|||.....||..|..|.|:
  Fly   206 KDRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVEGPFQVNENWTFAETIKGY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMB4NP_002787.2 proteasome_beta_type_4 52..247 CDD:239729 83/195 (43%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 79/191 (41%)
PRE1 60..232 CDD:223711 76/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155327
Domainoid 1 1.000 173 1.000 Domainoid score I3714
eggNOG 1 0.900 - - E1_KOG0185
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2090
Inparanoid 1 1.050 207 1.000 Inparanoid score I3707
Isobase 1 0.950 - 0 Normalized mean entropy S1013
OMA 1 1.010 - - QHG53720
OrthoDB 1 1.010 - - D1228942at2759
OrthoFinder 1 1.000 - - FOG0004376
OrthoInspector 1 1.000 - - oto90521
orthoMCL 1 0.900 - - OOG6_101718
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1012
SonicParanoid 1 1.000 - - X3101
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.