DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMB1 and Prosbeta3

DIOPT Version :9

Sequence 1:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster


Alignment Length:209 Identity:51/209 - (24%)
Similarity:97/209 - (46%) Gaps:11/209 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    35 FNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEAR 99
            :|||.::|:.|:|...:|:|.|........:.|..|.:.:..:..:|.:|...|.||:...:..|
  Fly     6 YNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFR 70

Human   100 LKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEG-KGAVYSFDPVGSYQR-DS 162
            ..:|:...|:.|.....:||:|:.||..||.||::..::.|||.:. :..:.:.|.:|.... |.
  Fly    71 KNLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDD 135

Human   163 FKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVT 227
            |...|:.:..|         :...:.:....|..|:...::....::|.:||..:|....:.|:.
  Fly   136 FVVAGTCAEQL---------YGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIE 191

Human   228 KEGIREETVSLRKD 241
            |:.|.|.|:..|.|
  Fly   192 KDKITERTLKTRMD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 50/207 (24%)
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 49/203 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D435362at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.