DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMB1 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:200 Identity:49/200 - (24%)
Similarity:94/200 - (47%) Gaps:21/200 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    37 GGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGC-SGFHGDCLTLTKIIEARL 100
            |.||:.|..:|..|:.:|||.:||..:..::..|.:.|. |.:..| :|...|....|.:|.::|
  Fly    39 GTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLA-KNIYCCGAGTAADTEMTTDLISSQL 102

Human   101 KMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVY----NIIGGLDEEGKGAVYSFDPVGSYQRD 161
            ::::...::.:...|...||..:|     |.|..:    .::||:|:.|. .:||..|.||..:.
  Fly   103 ELHRLQTDREVRVVAANTMLKQML-----FRYQGHISAALVLGGVDKTGP-HIYSIHPHGSSDKL 161

Human   162 SFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIV 226
            .:...||.|.....:.:::  :|       ..||.:...:||:|...|....|:.:|..:.:|::
  Fly   162 PYATMGSGSLAAMTVFESR--WK-------PDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVI 217

Human   227 TKEGI 231
            .|..:
  Fly   218 RKGSV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 49/199 (25%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 47/196 (24%)
proteasome_beta_type_7 42..228 CDD:239732 47/196 (24%)
Pr_beta_C 232..264 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.