DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMB1 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:223 Identity:41/223 - (18%)
Similarity:82/223 - (36%) Gaps:45/223 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     4 STAMYSAPGRDLGMEPHRAAGPLQLRF-SPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRD 67
            |.:.:|..||           ..|:.: |..|...||::.|.|:|..::|.:..::.  .::..|
  Fly    11 SASQFSPDGR-----------VFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITS--KLYEPD 62

Human    68 S-PKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFF- 130
            : .:.:.:.....:..:|...|...:..|.......|:....:|:....:...::..:::...: 
  Fly    63 AGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYS 127

Human   131 ---PYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFK----AGGSASAMLQPLLDNQVGFKNMQN 188
               |:.:..|:...||.....:|..:|.||    ||.    |.|.|              |.:..
  Fly   128 AVRPFGLSIILASWDEVEGPQLYKIEPSGS----SFGYFACASGKA--------------KQLAK 174

Human   189 VEHVPLSLDRAMRLVKDVFISAAERDVY 216
            .|...|.:|  ||  .|..:.:|...:|
  Fly   175 TEMEKLKMD--MR--TDELVESAGEIIY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 36/197 (18%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 41/223 (18%)
PRE1 6..231 CDD:223711 41/223 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.