Sequence 1: | NP_002784.1 | Gene: | PSMB1 / 5689 | HGNCID: | 9537 | Length: | 241 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260511.1 | Gene: | Prosbeta4 / 34999 | FlyBaseID: | FBgn0032596 | Length: | 201 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 45/202 - (22%) |
---|---|---|---|
Similarity: | 79/202 - (39%) | Gaps: | 12/202 - (5%) |
- Green bases have known domain annotations that are detailed below.
Human 39 TILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMY 103
Human 104 KHSNNKAMTTGAIAAMLSTIL--YSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAG 166
Human 167 GSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGI 231
Human 232 RE-ETVS 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PSMB1 | NP_002784.1 | proteasome_beta_type_1 | 30..241 | CDD:239726 | 45/202 (22%) |
Prosbeta4 | NP_001260511.1 | PRE1 | 1..194 | CDD:223711 | 44/199 (22%) |
proteasome_beta_type_2 | 1..192 | CDD:239727 | 43/197 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |