DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMB1 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:213 Identity:55/213 - (25%)
Similarity:92/213 - (43%) Gaps:23/213 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    39 TILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMY 103
            |||.:.|.||.|:||||..::.......:..|.::::|..::..:|..||||..:..|...:.:|
  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLY 67

Human   104 KHSNNKAMTT-GA---IAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFK 164
            |.:|...:|. ||   |...||..|.|...|  .|..::||.|......::..|.:|:.....:.
  Fly    68 KITNGYDLTVRGAVHFIRRHLSAYLKSDCTF--QVSLLVGGYDLTSGPELHYIDYLGNSVPVRYG 130

Human   165 AGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLD--RAMRLVKDVFISAAERDVYTGDALRICIVT 227
            ..|:|.....|:|:           |.....:|  .|..::|...|...:|.|.....:.:.:::
  Fly   131 GHGAAMNFCTPILE-----------EFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLIS 184

Human   228 KEGIRE----ETVSLRKD 241
            |.||.:    ...|||.|
  Fly   185 KNGITKMNSINLESLRGD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 54/211 (26%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 55/213 (26%)
proteasome_beta_type_2 1..193 CDD:239727 51/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.