DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMB1 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:191 Identity:35/191 - (18%)
Similarity:71/191 - (37%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    33 YVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIE 97
            :|:.||.||.:          |:|.:.|..|.::...|..::....:...:|...||....:.:.
  Fly    77 FVYQGGIILCV----------DSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALT 131

Human    98 ARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDS 162
            ...::::....:.:...:.|..:|.:....:.....:..::.|...||...|| .|..|......
  Fly   132 RECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVY-VDSNGLRIHGK 195

Human   163 FKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRI 223
            ..|.||.:.....:||:..         .:.||.:.|..|.......|...|:::|..:|:
  Fly   196 LFAVGSGAPNALGILDSDY---------RLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 35/191 (18%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 35/191 (18%)
proteasome_beta_type_5 72..259 CDD:239730 35/191 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.