DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxsr1a and Pak

DIOPT Version :9

Sequence 1:NP_001092217.1 Gene:oxsr1a / 568602 ZFINID:ZDB-GENE-070620-25 Length:515 Species:Danio rerio
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:292 Identity:114/292 - (39%)
Similarity:161/292 - (55%) Gaps:31/292 - (10%)


- Green bases have known domain annotations that are detailed below.


Zfish     4 DPSSQPWSIDKDDYELQEVIGSGATAVVQAAYCKPRKEKVAIKRINLEKCQTSMDELLKEIQAMS 68
            ||:.:        |...|.||.||:..|..|.......:||||::||.: |...:.::.||..|.
  Fly   561 DPNRK--------YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEILVMR 616

Zfish    69 QCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDFIKYIISKGEHKSGVMDEPSIATILREVLEG 133
            :..|||:|:|..|::|.:|||:||:.|.|||:.|.:         ....|||..||.:.||||:.
  Fly   617 ENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV---------TETCMDEGQIAAVCREVLQA 672

Zfish   134 LEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDMTRNKVRKTFVGTPCWMAPEVM 198
            ||:||.|..||||:|:.|||||.||||::.|||..|.::     .....|.|.||||.||||||:
  Fly   673 LEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQIS-----PEQSKRTTMVGTPYWMAPEVV 732

Zfish   199 EQVRGYDFKADLWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGVTDKEMVKKYGKS 263
            .: :.|..|.||||.||.|||:..|..||....|:|.|.|...|..|    .:.:|:   |...:
  Fly   733 TR-KQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKP----EIKEKD---KLSSA 789

Zfish   264 FRKMISLCLQKDPEKRPTAAELLKHKFFTKAK 295
            |:..:..||:.:.::|.:|.:||||.|...|:
  Fly   790 FQDFLDQCLEVEVDRRASALDLLKHPFLKLAR 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxsr1aNP_001092217.1 STKc_OSR1_SPAK 15..291 CDD:270787 110/275 (40%)
S_TKc 17..291 CDD:214567 110/273 (40%)
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 113/287 (39%)
S_TKc 566..817 CDD:214567 110/273 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.