DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha1

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster


Alignment Length:237 Identity:69/237 - (29%)
Similarity:128/237 - (54%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEID 71
            :||.:..|||||||:|||||.:|| :...|.:.:::.:...:|.:|::|...:.|.::..:..|.
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73

Human    72 AHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRP 136
            ..|||||:|.|||:::.:.|||.|..|..:.|...|.|:.:.:.::::...:.:     .|..||
  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQ-----NAEMRP 133

Human   137 FGVALLFGGVD-EKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLI 200
            .|.:::....| |.||.::..||:|.|....|.::|:.:..|.|.|::.|..:::.::||:.::.
  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAIS 198

Human   201 ILKQVMEEKLNATNIELATVQPGQ-NFHMFTKEELEEVIKDI 241
            .|..|:........||:..|.... .|.:..:.|:||.:..|
  Fly   199 CLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 63/213 (30%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 69/237 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 63/213 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.