DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:200 Identity:53/200 - (26%)
Similarity:80/200 - (40%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 DRGVNTFSPEGRLFQ--------VEYAIE---AIKLGSTAIGIQTSEGVCLAVEKRITS-PLMEP 61
            ||......|.|..|.        .|..:|   :...|:|.:||....||.:..|.|.|| .::..
  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77

Human    62 SSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWF-TYNETMTVESVTQAVSNLALQF-G 124
            .:..||:|:.|:|..|.:|...|.|.|::..|.:.:.|.. |....:.|....|.:..|..:| |
  Fly    78 KTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG 142

Human   125 EEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSM 189
            ..|||           ::.||.|..|..||          | .|:.||......:|:...|..||
  Fly   143 NIDAD-----------MIIGGADNTGAHLF----------C-TRSDGSTDTAPFTSIGSGYQVSM 185

Human   190 TLKEA 194
            ::.|:
  Fly   186 SILES 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 53/199 (27%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 53/199 (27%)
proteasome_beta_type_7 50..239 CDD:239732 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.