DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:202 Identity:48/202 - (23%)
Similarity:87/202 - (43%) Gaps:46/202 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    34 GSTAIGIQTSEGVCLAVEKRITS-PLMEPSSIEKIVEIDAHIGCAMSGLIADA----KTLIDKAR 93
            |:|.:|.:...||.|..:.|.|| ..:...::.||||::.::...::|..||.    :.|..:.|
  Fly    71 GTTTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECR 135

Human    94 VETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFG----GVDEKGPQLF 154
            :    |...|.:.|||::..:.:.|::.::.             |:.|:.|    |.|::||:|.
  Fly   136 L----HQLRYRKRMTVDTAARIICNISTEYK-------------GMGLVMGMMLAGFDDEGPKLI 183

Human   155 HMDPSGTFVQCDARAIGSASEGAQSSL----------QE--------VYHKSMTLKEAIKSSLII 201
            ::|..|........::||.|..|...|          ||        :||  .|.|:|....::.
  Fly   184 YVDSEGMRSHGQVFSVGSGSPYALGVLDTGYRYDLSDQEAYDLARRAIYH--ATSKDAYSGGIVR 246

Human   202 LKQVMEE 208
            |..:..|
  Fly   247 LYHIHSE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 48/202 (24%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 48/202 (24%)
proteasome_beta_type_5 72..259 CDD:239730 47/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.