DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:243 Identity:172/243 - (70%)
Similarity:204/243 - (83%) Gaps:2/243 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIE 65
            ||||||||||||||||||||||||||||||||||||||||.|.|||.||||||||||||.||::|
  Fly     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVE 65

Human    66 KIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEE-DAD 129
            ||||:|.|||||.|||:|||:|||::||||.|||||.|||.|::||..||||.||:|||:. |:|
  Fly    66 KIVEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSD 130

Human   130 -PGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKE 193
             ..|||||||||:||.|::...|||:|||||||||:..|:||||.|||||.:||:::...:||.|
  Fly   131 GAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDE 195

Human   194 AIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI 241
            ||..||..||||||||||:||:|:.|:...:.|:||||||:|:.||:|
  Fly   196 AIDISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 153/213 (72%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 164/234 (70%)
proteasome_alpha_type_5 8..222 CDD:239722 153/213 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143507
Domainoid 1 1.000 255 1.000 Domainoid score I2055
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2084
Inparanoid 1 1.050 336 1.000 Inparanoid score I2405
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54013
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0004131
OrthoInspector 1 1.000 - - oto88905
orthoMCL 1 0.900 - - OOG6_101621
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1007
SonicParanoid 1 1.000 - - X2875
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.