DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:234 Identity:76/234 - (32%)
Similarity:128/234 - (54%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDA 72
            ||...:.|||:||:||::||.:|::...|.|||:..:.|.|||||.|||.|.||.:..:|..|:.
  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72

Human    73 HIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPF 137
            :||.|::||:||...:.|.||.|..|:...:.:.:.::.:...|:.....:....|     .|||
  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSA-----VRPF 132

Human   138 GVALLFGGVDE-KGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLII 201
            |::::....|| :||||:.::|||:.....|.|.|.|.:.|::.:::: ...|...|.::|:..|
  Fly   133 GLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKL-KMDMRTDELVESAGEI 196

Human   202 LKQVMEE-KLNATNIELATVQPGQ---NFHMFTKEELEE 236
            :.:|.:| |......|:..|  |:   ..|:....||.|
  Fly   197 IYKVHDELKDKDFRFEMGLV--GRVTGGLHLINPSELTE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 70/213 (33%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 70/213 (33%)
PRE1 6..231 CDD:223711 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.