Sequence 1: | NP_002781.2 | Gene: | PSMA5 / 5686 | HGNCID: | 9534 | Length: | 241 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572267.1 | Gene: | Prosbeta2R1 / 31511 | FlyBaseID: | FBgn0029812 | Length: | 307 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 50/202 - (24%) |
---|---|---|---|
Similarity: | 87/202 - (43%) | Gaps: | 28/202 - (13%) |
- Green bases have known domain annotations that are detailed below.
Human 29 EAIKLGSTAIGIQTSEGVCLAVEKRIT-SPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKA 92
Human 93 RVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMD 157
Human 158 PSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNA---------T 213
Human 214 NIELATV 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PSMA5 | NP_002781.2 | proteasome_alpha_type_5 | 8..220 | CDD:239722 | 50/200 (25%) |
Prosbeta2R1 | NP_572267.1 | 20S_bact_beta | 48..241 | CDD:163402 | 47/197 (24%) |
proteasome_beta_type_7 | 49..236 | CDD:239732 | 46/196 (23%) | ||
Pr_beta_C | 241..274 | CDD:289249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |