DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:202 Identity:50/202 - (24%)
Similarity:87/202 - (43%) Gaps:28/202 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    29 EAIKLGSTAIGIQTSEGVCLAVEKRIT-SPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKA 92
            :|||.|::.:||...:||.|..:.|.| .|::...:..||..:..||.|..:|..||.:.:....
  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107

Human    93 RVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMD 157
            ..|...|.......:.|...:..:.....::          ....|.||:.||||..||||:.:.
  Fly   108 SAELDLHRLNTERRVPVVCASMMLRRTLFRY----------QGHIGAALVMGGVDTTGPQLYCIY 162

Human   158 PSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNA---------T 213
            |.|:..:....|:||.:..|.|.|:..:...:.|::.        ||::.|.::|         :
  Fly   163 PCGSNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQG--------KQLVREAISAGVFNDLGSGS 219

Human   214 NIELATV 220
            ||:|..:
  Fly   220 NIDLCVI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 50/200 (25%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 47/197 (24%)
proteasome_beta_type_7 49..236 CDD:239732 46/196 (23%)
Pr_beta_C 241..274 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.