DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dkk2 and NimB2

DIOPT Version :9

Sequence 1:XP_006501881.1 Gene:Dkk2 / 56811 MGIID:1890663 Length:272 Species:Mus musculus
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:175 Identity:43/175 - (24%)
Similarity:58/175 - (33%) Gaps:45/175 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    67 KKGKSLGQVGNPPKHTLQPGEAYPCSSDKECEVGRYCHSPHQGS-SACMLCRRKKKRCHRDGMCC 130
            |.|.|.|:...|.|.....|  |..::|..||  ..|.|...|. :|...|..........|.|.
  Fly   254 KPGCSFGRCVAPNKCACLDG--YRLAADGSCE--PVCDSCENGKCTAPGHCNCNAGYLKLQGRCE 314

Mouse   131 P--GTRCNNGICI---------------PVTESILTPHIPALD----GTRHRDRNHGHYSNHDLG 174
            |  ...|.||.||               ...|.:....:|.|:    |....|...|:.  .|..
  Fly   315 PICSIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTGYV--RDEH 377

Mouse   175 WQNLGRPHSKMPHIKGHEGDPCLRSSDCIDGFCCARHFWTKICKP 219
            .:|:.:||             |  ...|.:|:|.|.:|.  ||:|
  Fly   378 QRNICQPH-------------C--PQGCQNGYCSAPNFC--ICRP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dkk2XP_006501881.1 Dickkopf_N 91..141 CDD:368068 14/52 (27%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.