DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSKH1 and Pskh1

DIOPT Version :9

Sequence 1:NP_006733.1 Gene:PSKH1 / 5681 HGNCID:9529 Length:424 Species:Homo sapiens
Sequence 2:NP_001102367.1 Gene:Pskh1 / 364993 RGDID:1304648 Length:44 Species:Rattus norvegicus


Alignment Length:33 Identity:11/33 - (33%)
Similarity:12/33 - (36%) Gaps:20/33 - (60%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGCGTSK--------------------VLPEPP 13
            |||||||                    .||:||
  Rat     1 MGCGTSKKSSPTFVLSFGVLPFAASLLELPDPP 33

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSKH1NP_006733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..80
STKc_PSKH1 96..355 CDD:270989
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..407
Pskh1NP_001102367.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83695048
Domainoid 1 1.000 518 1.000 Domainoid score I6661
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 832 1.000 Inparanoid score I7136
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53505
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 1 1.000 - - oto136320
orthoMCL 1 0.900 - - OOG6_109509
Panther 1 1.100 - - LDO PTHR24347
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.400

Return to query results.
Submit another query.