DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG11 and ceacam1

DIOPT Version :9

Sequence 1:NP_002776.3 Gene:PSG11 / 5680 HGNCID:9516 Length:335 Species:Homo sapiens
Sequence 2:NP_001107266.1 Gene:ceacam1 / 114465 ZFINID:ZDB-GENE-010724-14 Length:1025 Species:Danio rerio


Alignment Length:317 Identity:94/317 - (29%)
Similarity:151/317 - (47%) Gaps:56/317 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    31 PTTAQVMIEAQPPKVSEGKDVLLLVH-NLPQNL--------TGYIWYKGQIRDLYHYITSYVVDG 86
            |...||.:......|:.|.:|.|.|: ::|..:        |.::||.|.|.             
Zfish    15 PGLCQVNVVPSNNPVAVGSNVTLDVNSSMPITVGLWLFGPSTLFMWYMGDII------------- 66

Human    87 QIIIYGPAYSGRETVYSNAS---LLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTFTLYLETPK 148
                  |..|.:..||.|:|   |.:..||.|.:|.|.|.:.|.......:|        ||..:
Zfish    67 ------PGNSLQPGVYFNSSTYQLTLSAVTLESSGVYVLDVYKPNRIRSEIT--------LEVQE 117

Human   149 P------SISSSNLNPREAMETVILTCNPETPDASYLW--WMNGQS-LPMTHRMQLSETNRTLFL 204
            |      :::::||  .|..:||..||:..|   |.:|  |:||.| :....|:||..:.:||.:
Zfish   118 PVGNVNTTVNTTNL--VEVNDTVYFTCSVTT---SPVWFSWLNGNSAVKDGGRVQLQNSGQTLII 177

Human   205 FGVTKYTAGPYECEIWNSGSASRSDPVTLNLLHGPDLPRI--FPSVTSYYSGENLDLSCFANSNP 267
            .|||:|..||::|.:.|:.|:.:|..:.||:.:||....:  .|..|.|.||.|..|||.|:|.|
Zfish   178 NGVTRYDEGPFKCVVVNNISSQQSVEMKLNISYGPGNLTLTAMPEKTVYISGSNFSLSCSADSKP 242

Human   268 PAQYSWTINGK-FQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSLTIRVIAP 323
            .|.::|.:||. ..::|......:.|...:|:|.|.|:|:||...::.:.|||::.|
Zfish   243 TATFNWMLNGNLLNVNGPVYVFTKATQNQSGVYTCGAQNAATLRYAAVTKTIRIVDP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG11NP_002776.3 Ig_CEACAM_D1 36..138 CDD:143251 27/113 (24%)
IG_like 45..>121 CDD:214653 22/87 (25%)
Cell attachment site. /evidence=ECO:0000255 127..129 0/1 (0%)
Ig 148..236 CDD:299845 32/96 (33%)
IG_like 163..223 CDD:214653 24/62 (39%)
Ig_2 242..320 CDD:290606 27/80 (34%)
IG_like 246..318 CDD:214653 25/72 (35%)
ceacam1NP_001107266.1 Ig 32..115 CDD:299845 26/109 (24%)
Ig 133..208 CDD:299845 28/77 (36%)
IG_like 221..291 CDD:214653 25/69 (36%)
Ig_2 221..284 CDD:290606 23/62 (37%)
Ig 298..387 CDD:299845 1/2 (50%)
Ig_2 400..469 CDD:290606
IG 400..456 CDD:214652
Ig 480..564 CDD:299845
IG_like 494..559 CDD:214653
IG_like 578..648 CDD:214653
Ig_2 579..648 CDD:290606
Ig_CEACAM_D4 650..741 CDD:143217
IG_like 653..740 CDD:214653
Ig_2 752..825 CDD:290606
IG_like 755..825 CDD:214653
Ig 827..917 CDD:299845
IG_like 836..917 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I34796
eggNOG 1 0.900 - - E1_29WEF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312709at7742
OrthoFinder 1 1.000 - - FOG0000658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44337
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.