DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG9 and igcm-1

DIOPT Version :9

Sequence 1:XP_016882493.1 Gene:PSG9 / 5678 HGNCID:9526 Length:495 Species:Homo sapiens
Sequence 2:NP_508166.1 Gene:igcm-1 / 180433 WormBaseID:WBGene00018215 Length:1073 Species:Caenorhabditis elegans


Alignment Length:458 Identity:93/458 - (20%)
Similarity:159/458 - (34%) Gaps:126/458 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    70 GEMTDLYHYIISYIVDGKII---IYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDET 131
            |....|.|:.::...|||.:   :...|..|.||....:|.|  ||..|.....|         .
 Worm   199 GATESLLHFRVTSSDDGKSVQCDVTNRAMLGGETKQVKSSQL--NVLYKPVVFVT---------P 252

Human   132 REEIRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQ-- 194
            .|.:.|.:.                   |..|.|.|.|             |..|.|..|..:  
 Worm   253 TENLTHLSV-------------------EEGELVNLTC-------------NSASNPPAHSYEWK 285

Human   195 -LSKTNR---TLYLFGVTKYIAGPYECEIRNPVSASRSD-PVTLNLLPKLPIPYITINNLNPREN 254
             ::...|   .::...|...::|.:||...|.:....:. .:.:..:|::.:|    .:::|.|.
 Worm   286 HIASGERYQGKIWPIRVDSSMSGDFECRSTNELGEGTAVLKMVV
QHIPRINVP----ESISPNEM 346

Human   255 KDVLAFTCEPKS-ENYTYIWWL-------NGQSLPVSPGVKRPIENRILILPSVTRNETGPYQC- 310
            :|: ...||..: .....|.|:       ||..|.::               |:::.::|.|.| 
 Worm   347 EDI-DILCEVSAVPEVIDIKWVGPNGFKQNGSRLTIT---------------SISKAQSGNYTCM 395

Human   311 --EIRDRYG------GLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTE--SNPPAEYF 365
              .....||      .:.:...|::|...|...:|..:......||.:.|.|..|  .||.|.|.
 Worm   396 ATN
FLTVYGHSGSQQRMGTGTTIVDVKRKPGQAQIVSARQNVDVGETIKLMCQAEDAGNPSASYT 460

Human   366 W---TINGKFQQSG--QKLF-IPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGKWIPASLAV 424
            |   :..|.|...|  :|.| :.....:.:|:|:|..:|.....:|...|...:....|.:.||.
 Worm   461 WASPSSGGIFGLEGHTEKSFEVRNAQLSDNGVYSCKAYNDLGEGKIGTVMITVIEKARISSPLAT 525

Human   425 ------------------GFYVESI-WLSE--KSQENIFIPSLCPMGTSKSQILLLNPPNLSLQT 468
                              |:....| ||.:  ..:::|:..|    .||:|:.|   |.:...||
 Worm   526 ERIFTSGEQGKILECEAQGYPSPVIKWLKDGRPVKQSIYASS----ATSESKCL---PEDFCTQT 583

Human   469 LFS 471
            :.|
 Worm   584 VAS 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG9XP_016882493.1 Ig_CEACAM_D1 36..133 CDD:143251 16/65 (25%)
IG_like 45..>121 CDD:214653 15/53 (28%)
Ig 148..236 CDD:299845 15/94 (16%)
Ig 242..329 CDD:299845 18/103 (17%)
IG_like 260..322 CDD:214653 13/78 (17%)
Ig_2 335..413 CDD:290606 22/85 (26%)
IG_like 339..413 CDD:214653 21/81 (26%)
igcm-1NP_508166.1 Ig 45..119 CDD:299845
Ig 146..226 CDD:299845 6/26 (23%)
Ig_3 245..316 CDD:290638 18/111 (16%)
IG_like 258..329 CDD:214653 16/102 (16%)
IG_like 338..398 CDD:214653 15/79 (19%)
IGc2 347..398 CDD:197706 12/66 (18%)
Ig_2 429..513 CDD:290606 22/83 (27%)
IG_like 437..513 CDD:214653 21/75 (28%)
Ig 537..615 CDD:143165 14/57 (25%)
IG_like 644..728 CDD:214653
IGc2 646..719 CDD:197706
FN3 733..843 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I9249
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.