DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG9 and ceacam8l

DIOPT Version :9

Sequence 1:XP_016882493.1 Gene:PSG9 / 5678 HGNCID:9526 Length:495 Species:Homo sapiens
Sequence 2:XP_031761715.1 Gene:ceacam8l / 101730286 XenbaseID:XB-GENE-22169429 Length:407 Species:Xenopus tropicalis


Alignment Length:419 Identity:102/419 - (24%)
Similarity:153/419 - (36%) Gaps:107/419 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     9 CTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMT 73
            |...:|....:|..||..:.:......|.:..|.|.||:  .|.|.|..:...:..:.||||...
 Frog     4 CRHLLTQCCWMLAVSLSAWMDGAHGIGVQLIPQYPVVSQ--SVTLSVTGVTGTIRQFSWYKGSSA 66

Human    74 DLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHF 138
            |..:.|.|.|.....:..||.|..|.....|.||.|..:...|.|.||:.:......|::.:   
 Frog    67 DTNNQIFSVIPSANSVTKGPQYFPRANWLPNGSLQISGLVPTDQGNYTVLMYTAESTTQDTV--- 128

Human   139 TFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQLSKTNRTLY 203
                                                           ||||              
 Frog   129 -----------------------------------------------SLPV-------------- 132

Human   204 LFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPIPYITINNLNPRENKDVLAFTCEPKSEN 268
                       ||     |||:|.                |:.:|..|:||:.| ..||...:..
 Frog   133 -----------YE-----PVSSSG----------------ISTDNKEPQENQPV-TLTCSANNAE 164

Human   269 YTYIWWLNGQSLPVSPGVKRPIENRILILPSVTRNETGPYQCEIRDRYGGLRSNPVILNVLYGPD 333
             ..:|..||  :|:.||:....:||.|..|.::|::||.|:||..:....:.|:|..|.|.|||:
 Frog   165 -QILWSKNG--VPLPPGLTLSADNRTLTFPRISRSDTGQYRCEASNAVSKIISDPYTLTVNYGPE 226

Human   334 LPRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTING-KFQQSGQKLFIPQITRNHSGLYACSVH 397
            ..:|..:. ...||.:..|.|..:|.|...|.|..|| ..:.....|:|.|.|...:|.|.|...
 Frog   227 NLKIKGTL-QVTSGYSTSLECSADSVPAPTYQWKFNGTNLESQTNTLYIQQATPESAGNYTCIGT 290

Human   398 NSATGKEISKSMTVKVS-GKWIPASLAVG 425
            ||.|  ::|:..:|.|| ..:.|:...:|
 Frog   291 NSVT--KLSRETSVYVSVNDYNPSDNPIG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG9XP_016882493.1 Ig_CEACAM_D1 36..133 CDD:143251 29/96 (30%)
IG_like 45..>121 CDD:214653 23/75 (31%)
Ig 148..236 CDD:299845 10/87 (11%)
Ig 242..329 CDD:299845 27/86 (31%)
IG_like 260..322 CDD:214653 18/61 (30%)
Ig_2 335..413 CDD:290606 23/78 (29%)
IG_like 339..413 CDD:214653 22/74 (30%)
ceacam8lXP_031761715.1 Ig 29..132 CDD:416386 31/154 (20%)
FR1 30..48 CDD:409353 7/19 (37%)
Ig strand A 30..32 CDD:409353 0/1 (0%)
Ig strand A' 37..39 CDD:409353 0/1 (0%)
Ig strand B 42..49 CDD:409353 2/8 (25%)
CDR1 49..56 CDD:409353 0/6 (0%)
FR2 57..62 CDD:409353 1/4 (25%)
Ig strand C 57..61 CDD:409353 0/3 (0%)
CDR2 63..84 CDD:409353 5/20 (25%)
Ig strand C' 71..76 CDD:409353 2/4 (50%)
Ig strand C' 81..84 CDD:409353 0/2 (0%)
FR3 91..117 CDD:409353 9/25 (36%)
Ig strand D 91..96 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 2/3 (67%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
CDR3 118..124 CDD:409353 0/5 (0%)
FR4 125..132 CDD:409353 2/56 (4%)
Ig strand G 125..131 CDD:409353 1/55 (2%)
Ig 139..222 CDD:416386 28/102 (27%)
Ig strand A 139..142 CDD:409353 1/18 (6%)
Ig strand A' 145..150 CDD:409353 2/4 (50%)
Ig strand B 154..160 CDD:409353 3/6 (50%)
Ig strand C 166..171 CDD:409353 1/4 (25%)
Ig strand C' 173..176 CDD:409353 1/2 (50%)
Ig strand D 178..182 CDD:409353 1/3 (33%)
Ig strand E 185..190 CDD:409353 3/4 (75%)
Ig strand F 200..208 CDD:409353 3/7 (43%)
Ig strand G 212..221 CDD:409353 3/8 (38%)
Ig strand A' 233..236 CDD:409353 0/3 (0%)
Ig_3 236..291 CDD:404760 17/54 (31%)
Ig strand B 241..249 CDD:409353 2/7 (29%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand C' 262..265 CDD:409353 1/2 (50%)
Ig strand E 270..275 CDD:409353 1/4 (25%)
Ig strand F 283..291 CDD:409353 3/7 (43%)
Ig strand G 294..304 CDD:409353 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I12550
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D241176at32523
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.