DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-241l7.3 and lectin-22C

DIOPT Version :9

Sequence 1:XP_021324414.1 Gene:si:dkey-241l7.3 / 567766 ZFINID:ZDB-GENE-041014-239 Length:162 Species:Danio rerio
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:116 Identity:30/116 - (25%)
Similarity:50/116 - (43%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


Zfish    23 ERLRCER--------------------GWSGSGSRCFRFFSRS-VNWVTAERNCQSLGGNLASVH 66
            |||.|..                    |:...||:.:.....| .||.||.:.|:::||:||.:.
  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175

Zfish    67 DQVENDFLLTLVPGSTRCWIGGHDGEQDGQWL-WSDGSVYGYTNWCSGEPS 116
            |:.:...:...:...|..|:|.:|.:.:|::| ...|....:..|.||.||
  Fly   176 DEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-241l7.3XP_021324414.1 CLECT 27..126 CDD:214480 27/112 (24%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.