powered by:
Protein Alignment si:dkey-241l7.6 and lectin-22C
DIOPT Version :9
Sequence 1: | XP_021324413.1 |
Gene: | si:dkey-241l7.6 / 567708 |
ZFINID: | ZDB-GENE-041014-235 |
Length: | 156 |
Species: | Danio rerio |
Sequence 2: | NP_001137766.1 |
Gene: | lectin-22C / 7354375 |
FlyBaseID: | FBgn0259230 |
Length: | 263 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 40/71 - (56%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Zfish 50 NWVTAERNCQSLGGNLASVHDEDENDFLLGLVPVSTRCWIGGHDGEQDGQWL-WSDGSVYSYTNW 113
||.||.:.|:::||:||.:.||.:...:...:...|..|:|.:|.:.:|::| ...|...::..|
Fly 156 NWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKW 220
Zfish 114 CSGEPS 119
.||.||
Fly 221 ASGRPS 226
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
si:dkey-241l7.6 | XP_021324413.1 |
CLECT |
30..149 |
CDD:214480 |
23/71 (32%) |
lectin-22C | NP_001137766.1 |
CLECT |
146..255 |
CDD:153057 |
23/71 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100086 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.