DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aebp1b and DIP-delta

DIOPT Version :9

Sequence 1:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:151 Identity:31/151 - (20%)
Similarity:56/151 - (37%) Gaps:40/151 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish    35 ISHTD-------REQHVEDR-------------------NVTSVEDLLQVKIIPPYATIEVGQHK 73
            |::||       .:.|.:||                   .|....::|.::..|....:...|:.
  Fly   101 ITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNI 165

Zfish    74 QLLCKVSS-DAKNINWVSPNGEKV-LTKHGNLKVHNHGSVLSSLTVLNANLNNAGIYKCVATNGD 136
            .:.|:... .|..|.|...:||:: :.|...:.|::    ...|.:...:.|..|.|.|:||||.
  Fly   166 NMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYD----ADVLPLTKVSRNEMGAYLCIATNGV 226

Zfish   137 TESQATVKLDIILKRMRRDTD 157
            ..|        :.||:..|.:
  Fly   227 PPS--------VSKRIILDVE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aebp1bXP_696022.6 Ig 56..147 CDD:299845 21/92 (23%)
IG_like 62..145 CDD:214653 20/84 (24%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 7/41 (17%)
Ig 145..238 CDD:416386 23/104 (22%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386
Ig strand A' 250..253 CDD:409353
Ig strand B 259..266 CDD:409353
Ig strand C 272..277 CDD:409353
Ig strand C' 281..283 CDD:409353
Ig strand D 289..293 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 314..322 CDD:409353
Ig strand G 325..334 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.