DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Litaf and CG32280

DIOPT Version :9

Sequence 1:NP_064364.1 Gene:Litaf / 56722 MGIID:1929512 Length:161 Species:Mus musculus
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:163 Identity:60/163 - (36%)
Similarity:71/163 - (43%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSAPG--PYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYT 63
            ||.||  |.|....|.  |:|||:|:|.||                          |:.|...||
  Fly     1 MSKPGSAPPQFTYVPP--PSAPPSYQEAVG--------------------------GVKPVGPYT 37

Mouse    64 QPV-PVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGC 127
            ..| |...||...|.||.   |:|  .....|.||||...|.|......|.:.:||...:.|.||
  Fly    38 PVVAPATTANTTIVTTVV---PIS--RTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGC 97

Mouse   128 VAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160
            ..|||.||.|:|...||.|.||||:|.||.|:|
  Fly    98 WLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LitafNP_064364.1 PPxY motif 20..23 2/2 (100%)
zf-LITAF-like 91..159 CDD:371158 30/67 (45%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 111..134 9/22 (41%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm11118
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - LDO PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.