DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atf7b and kay

DIOPT Version :9

Sequence 1:XP_005166106.1 Gene:atf7b / 567018 ZFINID:ZDB-GENE-030131-3028 Length:459 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:426 Identity:90/426 - (21%)
Similarity:155/426 - (36%) Gaps:127/426 - (29%)


- Green bases have known domain annotations that are detailed below.


Zfish   115 PPDSPDSASSMTNSKDTVAMAKEAIALRKAKDVPPRT-----AASSTPTPTIVRPGSLPLHQGFD 174
            |.:|..|||..  :.:|...|:.|:...........|     ||:::.|.|....||...|....
  Fly   153 PSESQSSASGW--NPETPGQAQLALTATTCNTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNF 215

Zfish   175 SMNPTQ-----------------PSPTSVITRTPP----------------------SNRLSSPS 200
            :|:.::                 .:..||:|.|.|                      ::|::..:
  Fly   216 AMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCA 280

Zfish   201 GSFPMLMQLPNGQTVPLLPSPGQTSVISLARSSNTVPNIPGIPGPPIGGSSSGSSSPSGY----- 260
            | |.:...|||...|..:..|...|.:.|.::.:.          .:|..|....|.:.|     
  Fly   281 G-FAVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDL----------SLGQGSESEDSNASYNDTQM 334

Zfish   261 ----------STHSDAK--------------------TRLKAALSQPSPSGPAPIQKTDHTETPS 295
                      |.|:|:.                    :.:.||:|  |..|.|.:..::...:.:
  Fly   335 NEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVS--SSRGSASVGSSNANTSNT 397

Zfish   296 PAQPQVSPAPPKGGRRR--RGADIEPDERRRRFL--ERNRAAASRCRQKRKVWVSALEKRAEELA 356
            ||:        :||.||  |..::.|:|.::|.:  |||:.||:|||::|....:.|.:..|:|.
  Fly   398 PAR--------RGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLE 454

Zfish   357 NANVSLTGEVSLLRTEVTRLKELLLAHKDCPVTAMQKKAYLAAGVDESSVSALVMPVTVPAPVSV 421
            ....|:..|:.:|.....:|:.||..|:   .|..:.::      |..||            |:.
  Fly   455 KRGESMRKEIEVLTNSKNQLEYLLATHR---ATCQKIRS------DMLSV------------VTC 498

Zfish   422 NGLSVRAAEAVAVLAGMGSGQWSNSAGDASSQSQPT 457
            |||...|....|..:|.|:....|...:.||....|
  Fly   499 NGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTIT 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atf7bXP_005166106.1 C2H2 Zn finger 9..31 CDD:275368
bZIP_ATF2 332..382 CDD:269835 15/49 (31%)
coiled coil 332..382 CDD:269835 15/49 (31%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/60 (32%)
coiled coil 421..480 CDD:269869 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5099
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.