DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG2 and wrk-1

DIOPT Version :9

Sequence 1:NP_112536.2 Gene:PSG2 / 5670 HGNCID:9519 Length:335 Species:Homo sapiens
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:355 Identity:74/355 - (20%)
Similarity:125/355 - (35%) Gaps:84/355 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    17 GLLVTASLLNFWNLPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITS 81
            |||:.:         |:||:..:.......||:. |.|...:.......||.|.         |.
 Worm    10 GLLIAS---------TSAQIRTKGGTLIAKEGES-LTLRCEVEDPSVAIIWRKN---------TE 55

Human    82 YV-VDGQIIIYGPAYSGRETAY--SNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTFTLY 143
            .| ||.:|:   ..|.|.|.:.  |.:.|.|:.|...::.:|:..:.:.....       ||.:.
 Worm    56 VVAVDDEIL---DTYGGYEISMEGSTSVLTIKRVEPINSANYSCALAEPEVSV-------TFVIK 110

Human   144 LETPKPS-ISSSNL----------NPREAMETVILTCDPE--TPDTSYQWWMNGQSLPMTHRFQL 195
            ::..||: :|...|          :.|...:.:::||..:  .|.....|......||  ...:.
 Worm   111 VQVFKPTQVSVKPLVVISPDTGVYHARVGEKNLVITCHVKEGNPKPGVVWTKQAAKLP--EDIKR 173

Human   196 SETNRTLFLFGVTKYTAGPYECEIRNSGSASRSDPVTLNL-----LHG--PDLPRI--HPSYTNY 251
            ......:.:..|.|:.||.|.|...|   .:.||..|:::     |.|  .:.|.:  ..::...
 Worm   174 EHGGARIVITEVKKHHAGKYNCLAEN---IAGSDRATIDIHVAEPLQGEREEKPWVKNEDTFIPV 235

Human   252 RSGDNLYLSCFANSNPPAQYSWTING--------KFQQSGQ-----------NLFIPQITTKHSG 297
            |...|....|..:..|..|..|..||        ||:::.:           .|.:..|:.:..|
 Worm   236 RKNQNASFWCTYDGTPVPQVEWLFNGYKINFNDEKFKKTSETAQRLNGYSKSTLTVGDISEEAFG 300

Human   298 LYVCSVRNSATGEESSTSLTVKVSASTRIG 327
            .|.|.:.|..      .|:|..|..|.|.|
 Worm   301 DYACRISNKL------GSVTAVVHVSGRPG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG2NP_112536.2 Ig_CEACAM_D1 36..138 CDD:143251 20/104 (19%)
IG_like 45..>121 CDD:214653 19/78 (24%)
Ig 148..236 CDD:299845 21/105 (20%)
Ig_2 242..320 CDD:290606 19/98 (19%)
IG_like 246..318 CDD:214653 17/90 (19%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 22/107 (21%)
IGc2 31..96 CDD:197706 20/77 (26%)
IG_like 132..212 CDD:214653 17/84 (20%)
IGc2 142..202 CDD:197706 13/64 (20%)
IG_like 235..320 CDD:214653 19/90 (21%)
Ig 245..318 CDD:143165 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.