DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG1 and side-VIII

DIOPT Version :9

Sequence 1:NP_001284702.1 Gene:PSG1 / 5669 HGNCID:9514 Length:428 Species:Homo sapiens
Sequence 2:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster


Alignment Length:588 Identity:120/588 - (20%)
Similarity:179/588 - (30%) Gaps:233/588 - (39%)


- Green bases have known domain annotations that are detailed below.


Human     3 TLSAPPCTQRIKWKGLLLTASLLNFWNLPTTA----QVTIEAEPTKVSEGKDVLLL--------- 54
            :|..|.|         ||..|.||.   |..|    :|:.....|:..|.::.|||         
  Fly     8 SLFLPLC---------LLVLSALNG---PAAAASRVRVSSSTTMTRNIEEENALLLLLAGPPVLS 60

Human    55 ------VHNLPQNLTG---------YIWYKGQMR---------------------DLYHYITSYV 83
                  |..||.|:|.         .||||..::                     :.|....|:.
  Fly    61 ESIMGTVGRLPCNVTPPIYEDRVALVIWYKVGLKTPIYSVDTRDSNFAQGTHWSDETYRERLSFH 125

Human    84 VDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFT--------- 139
            |:|..                .:|.|::.|.:|.|.|...:......||......|         
  Fly   126 VEGRA----------------GTLTIKSTTEDDTGEYRCRVDFQKSPTRNSKVNLTVIIPPESVI 174

Human   140 ------FTLHLETPKPSISSSNLN-----------PRET-------------------------- 161
                  .|:...|..|....|.:|           ||.|                          
  Fly   175 ILDSKGVTIEDHTLGPYNEGSGINITCVAIGGRPQPRVTWLHGNTVYKNASVGQPLSERRVGNTL 239

Human   162 ----MEA----VSLTCDPET--------------------------------------------- 173
                :|.    :.|||..|.                                             
  Fly   240 SLARLERRNLHMQLTCRAENNNLTTPIISSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIG 304

Human   174 --PDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLL 236
              |..:..||.....:..||.:...:.|.|..:|..|.      ..:.|....:.|::.   :::
  Fly   305 ARPAPTITWWKGSTPMKNTHEIATPDGNLTTSVLTFTP------TIDDRGKFLSCRAEQ---SMI 360

Human   237 P--------KLPKPYITI-------NNLNP--RENKDVLNFTCEPKSENYTY--IWWLNGQSLPV 282
            |        ||...:|.:       |:||.  ||..||. |.|..||..:.|  .|..||:.|..
  Fly   361 PESGMEDGWKLDIYHIPVVSLELGTNSLNSTLREGIDVF-FECNIKSNPWIYEVSWRHNGKILTN 424

Human   283 SPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDL-PRIYPSFTYYRS 346
            :|.....:.|:.|:|.:.:|..:|.|.|...:|.|...|:||.|::.:.|.. ||...|   |.|
  Fly   425 NPAEGIAVSNQSLVLQNASRARSGIYTCVGSNREGDGESNPVQLDIRFAPVCRPRQRLS---YSS 486

Human   347 G--EVLYLSCSADSNP-PAQYSWTIN----EKFQLPGQKL------FIRH---ITTKHSGLYVCS 395
            |  |.:.::|..|:|| .|.|.|..|    |...:|..::      .|.|   :|....|..:|.
  Fly   487 GRHETVKVACEIDANPAEATYVWKFNATQGETVDIPASQVAVDRGRSIAHYTPMTENDYGTLLCW 551

Human   396 VRN 398
            ..|
  Fly   552 ATN 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG1NP_001284702.1 Ig_CEACAM_D1 36..138 CDD:143251 27/146 (18%)
IG_like 41..>121 CDD:214653 23/124 (19%)
Ig 148..236 CDD:299845 22/179 (12%)
IG_like 163..221 CDD:214653 14/108 (13%)
Ig 241..329 CDD:299845 31/98 (32%)
IG_like 256..328 CDD:214653 25/73 (34%)
Ig_2 335..413 CDD:290606 23/80 (29%)
IG_like 339..413 CDD:214653 21/76 (28%)
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 21/126 (17%)
IG_like 60..166 CDD:214653 21/121 (17%)
Ig 182..266 CDD:299845 13/83 (16%)
Ig 296..373 CDD:299845 14/85 (16%)
IG_like 389..464 CDD:214653 24/75 (32%)
IGc2 394..459 CDD:197706 21/65 (32%)
Ig_3 490..554 CDD:290638 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.