powered by:
Protein Alignment ASCL3 and CG33557
DIOPT Version :9
Sequence 1: | NP_065697.1 |
Gene: | ASCL3 / 56676 |
HGNCID: | 740 |
Length: | 181 |
Species: | Homo sapiens |
Sequence 2: | NP_001014730.1 |
Gene: | CG33557 / 3346145 |
FlyBaseID: | FBgn0053557 |
Length: | 150 |
Species: | Drosophila melanogaster |
Alignment Length: | 54 |
Identity: | 24/54 - (44%) |
Similarity: | 33/54 - (61%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 96 RKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLL 149
:|.|.|||.|...||..|..||:.:|.|.:.::|||:|.:|.|..||.:|.|.|
Fly 64 QKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ASCL3 | NP_065697.1 |
HLH |
99..149 |
CDD:197674 |
22/49 (45%) |
CG33557 | NP_001014730.1 |
HLH |
67..119 |
CDD:197674 |
23/51 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.