DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWNK and MDM38

DIOPT Version :10

Sequence 1:NP_068602.2 Gene:TWNK / 56652 HGNCID:1160 Length:684 Species:Homo sapiens
Sequence 2:NP_014615.1 Gene:MDM38 / 854130 SGDID:S000005387 Length:573 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:48/243 - (19%)
Similarity:84/243 - (34%) Gaps:90/243 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   514 IIDNLQFMMGHEQLSTDRIAAQDYIIGVFRKFATDNNCHVTLVIHPRKED---DDK--------- 566
            ::||         ||..::||....:.: |.|..||  .:...|..:.:|   |||         
Yeast   253 VLDN---------LSRPQLAAMSKFMSL-RPFGNDN--MLRYQIRSKLKDIMNDDKTIDYEGVES 305

Human   567 ----ELQTASIFGSAKA--------------------SQEADNVLILQDRKLVTG--PGKRYLQV 605
                ||..|.:....||                    .|:..:||::.......|  |.:.|.:.
Yeast   306 LSQEELYQACVSRGMKAYGVSKEDLVDNLKVWLELRLRQKIPSVLMVLSSTFTFGGLPKENYSKA 370

Human   606 ---------SKNRFDG---------------------DVGVFPLEFNKNSLTFSIPPKNKARLKK 640
                     :|:::|.                     :|....:..:|:|...:...|..|. ||
Yeast   371 FSPLAEKKETKSKYDDLLDLYYDGILQVLSSIPDPVYNVAKLDVSESKSSAAETEAEKQVAE-KK 434

Human   641 IKDDTGPVAKKPSSGKKGATTQNSEIC-SGQAPTP------DQPDTSK 681
            ||.:..|  ::.:..|:.||.:.|.|. :..|.||      ::.:|:|
Yeast   435 IKTEEKP--EETAIPKEEATAKESVIATTASAVTPKLVVVNEKAETAK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWNKNP_068602.2 Contributes to single strand DNA binding activity. /evidence=ECO:0000269|PubMed:18039713 1..121
N-terminal region (NTR). /evidence=ECO:0000269|PubMed:35914129 54..214
Required for hexamers formation and DNA helicase activity. /evidence=ECO:0000269|PubMed:18039713 121..372
Primase-like domain. /evidence=ECO:0000269|PubMed:35914129 215..335
TOPRIM_primases 259..335 CDD:173779
Twinkle_C 366..629 CDD:410867 31/182 (17%)
Maybe required for stable oligomeric structure. /evidence=ECO:0000269|PubMed:17324440 405..590 23/111 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 637..684 15/52 (29%)
Might negatively regulate ATPase activity. /evidence=ECO:0000269|PubMed:17324440 640..684 14/49 (29%)
MDM38NP_014615.1 LETM1_RBD 121..358 CDD:462258 23/116 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.