DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atf7a and kay

DIOPT Version :9

Sequence 1:NP_001025376.1 Gene:atf7a / 566279 ZFINID:ZDB-GENE-050721-2 Length:497 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:339 Identity:88/339 - (25%)
Similarity:129/339 - (38%) Gaps:98/339 - (28%)


- Green bases have known domain annotations that are detailed below.


Zfish   181 TMPSPTSVITHTPPSNRTLGSPTVPYPMMMLPNGQT----------VP-VLPGP-----MQMPSV 229
            |:.:||...|.|.....|||.        :|.:.||          || |||..     |.:|:.
  Fly   246 TLTTPTLTPTTTRNIEDTLGH--------LLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPTG 302

Zfish   230 ISLARPLCMVPNIPGIPGPPLGGSSSGSSSPSGYNPHAEAKMR-------LKAALSQQTSSAQGC 287
            :| :.||....::      .||..|....|.:.||   :.:|.       ..:|.:..||...|.
  Fly   303 VS-SLPLQQTFDL------SLGQGSESEDSNASYN---DTQMNEEQDTTDTSSAHTDSTSYQAGH 357

Zfish   288 L--------GVAMGSSAMVPQRVEQSQLLVQHPDAPSPAQPQVSPAQPTGGRR-RRTADDDPDER 343
            :        ||...|:.:......:....|    ..|.|....:||:..|||| .|:.:..|:|.
  Fly   358 IMAGSVNGGGVNNFSNVLAAVSSSRGSASV----GSSNANTSNTPARRGGGRRPNRSTNMTPEEE 418

Zfish   344 RQRFL--ERNRAAASRCRQKRKIWVNSLEKKAEELTSINVSLSNEVSHLRNEVAHLKQLLLAHKD 406
            ::|.:  |||:.||:|||::|....|.|.::.|:|.....|:..|:..|.|....|:.||..|: 
  Fly   419 QKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHR- 482

Zfish   407 CPVTNLQKKAAYLGDEHMKETSEPTGSPAPVIQHSSLAPSPSSVVGPNGLSSRAAAEAVAMSVLA 471
               ...||                       |:...|     |||..|||        :|.:.|.
  Fly   483 ---ATCQK-----------------------IRSDML-----SVVTCNGL--------IAPAGLL 508

Zfish   472 GMGSQQGGSGGPSH 485
            ..||  .|||..||
  Fly   509 SAGS--SGSGASSH 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atf7aNP_001025376.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 343..403 CDD:269835 21/61 (34%)
coiled coil 343..403 CDD:269835 21/61 (34%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 21/60 (35%)
coiled coil 421..480 CDD:269869 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5099
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.