DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment creb5b and CrebB

DIOPT Version :9

Sequence 1:XP_021322572.1 Gene:creb5b / 565910 ZFINID:ZDB-GENE-091020-6 Length:480 Species:Danio rerio
Sequence 2:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster


Alignment Length:390 Identity:78/390 - (20%)
Similarity:124/390 - (31%) Gaps:120/390 - (30%)


- Green bases have known domain annotations that are detailed below.


Zfish    40 PSIKNDNMLSDQTPTPTRFLKNCEEVGLFSEL----DCSIE-------QEFCKAQEEEDSKQNIT 93
            |..:..|..|.....||....|.:..|:.|.|    :|:|:       |...:.|....:..:..
  Fly    48 PQQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGV 112

Zfish    94 LHGQGGPNQHQQAHSRMTNHDSIVIQQALPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLRNRQ 158
            :....|..|.|||.:..|....:|.   :..|.:|:||...|....|:                 
  Fly   113 IQTAAGTQQQQQALAAATAMQKVVY---VAKPPNSTVIHTTPGNAVQV----------------- 157

Zfish   159 RQPLPASMPGTL-PDPTMQGSSAVLMPMERQMSMGSNMMGMQGPAHNNSCSSPHVPSMHSEAKLR 222
            |..:|.:.|..: |:|..|      .|.:...|:..:                  .|.|..::|.
  Fly   158 RNKIPPTFPCKIKPEPNTQ------HPEDSDESLSDD------------------DSQHHRSELT 198

Zfish   223 LKAALAHHPGGMANGSMNSMGHMMEMMPSRQDQTGHHHMHSHPHQHMQGPPHGYPHHGHHHPSHA 287
            .:                         ||          ::.....:.||.              
  Fly   199 RR-------------------------PS----------YNKIFTEISGPD-------------- 214

Zfish   288 QSVHHHPQSHGHHNSHPAHMHPAHGHQTSPHQAMHSAASQLSPAAQQMQPTQTLQSPLPSGGRRR 352
            .|....|.|.|..||           |.:...|..:||:.   :..|:.||..|.:.: |.....
  Fly   215 MSGASLPMSDGVLNS-----------QLAGTGAGGNAANS---SLMQLDPTYYLSNRM-SYNTNN 264

Zfish   353 RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVTMLKNEVTQLK 417
            ..:.||...:|...|::||.||..||:|:|.::..||.:...|...|..|..|:..||....|.|
  Fly   265 SGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSLKELYCQTK 329

Zfish   418  417
              Fly   330  329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
creb5bXP_021322572.1 bZIP_ATF2 362..421 CDD:269835 20/56 (36%)
coiled coil 362..421 CDD:269835 20/56 (36%)
CrebBNP_001334685.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.